Pfam domain
Pfam family: Ribosomal_S24e (PF01282.18)
Uniprot AC: E9BU11
RecName: 40S ribosomal protein S24
Begin-End: 29-108
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
IVEVNHPHWCGTVPTQLIRKKLATLYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLAS
LKRFEPNYRKTRMGFGKARL
Structures of the domain E9BU11 29-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 Z 30-105 None


© NPIDB team 2003 - 2019

text