Pfam domain
Pfam family: Ribosomal_S27e (PF01667.16)
Uniprot AC: E9BUA2
RecName: 40S ribosomal protein S27-1, putative
Begin-End: 29-83
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
PNSYFMDVSCPRCRQVTVVYSHATTSVECKGCSKKLCRPTGGKALLVEGCGYRRK
Structures of the domain E9BUA2 29-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 c 29-83 None


© NPIDB team 2003 - 2019

text