Pfam domain
Pfam family: HVO_2753_ZBP (PF07754.13)
Uniprot AC: E9PYI1
RecName: Zinc finger protein 568
Begin-End: 569-622
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
TCTTELFRHQKVHTGDRPHKCKECGKAFIRRSELTHHERSHSGEKPYECKECGK
Structures of the domain E9PYI1 569-622
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v3j X-ray 2.06 E 568-621  H-Bb H-Mj S-Bb L-Bb L-Mj 
5v3j X-ray 2.06 F 568-621  H-Bb H-Mj L-Bb L-Mj 
5v3m X-ray 2.09 C 568-621  H-Bb H-Mj L-Bb L-Mj 
5wjq X-ray 2.79 D 568-621  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text