Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: F1RHJ1
RecName: Uncharacterized protein
Begin-End: 91-154
Organism: Sus scrofa
Interaction Mode:   

Sequence:
LNTHYRYVGKTVDYRGTMIPSEAPLLHNQVKLVDPTDRKPTDVEWRFTEAGERVRVSTRS
GRII
Structures of the domain F1RHJ1 91-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 Y 92-154 None


© NPIDB team 2003 - 2019

text