Pfam domain
Pfam family: Ribosomal_L16 (PF00252.17)
Uniprot AC: F1RI89
RecName: Uncharacterized protein
Begin-End: 57-190
Organism: Sus scrofa
Interaction Mode:   

Sequence:
PLVPKVRRERKNLSDIRGPSTEATEFTEGRFAILALGGGYLHWGHFEMMRLTINRSMDPK
NMFALWRVPAPFKPITRKGMGQRMGGGKGAIDHYVTPVKAGRLIVEMGGRCEFKEVQGFL
DLVAHKLPFPAKAV
Structures of the domain F1RI89 57-190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 Q 60-190 None


© NPIDB team 2003 - 2020

text