Pfam domain
Pfam family: RNA_pol_L_2 (PF13656.8)
Uniprot AC: F1RKE4
RecName: Uncharacterized protein
Begin-End: 30-104
Organism: Sus scrofa
Interaction Mode:   

Sequence:
ACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTN
AITDLISELSLLEER
Structures of the domain F1RKE4 30-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 K 30-104 None
6gmh X-ray 3.1 K 30-104 None
6exv X-ray 3.6 K 30-104 None
6ted X-ray 3.1 K 30-104 None


© NPIDB team 2003 - 2021

text