Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: F1RMQ4
RecName: Uncharacterized protein
Begin-End: 28-126
Organism: Sus scrofa
Interaction Mode:   

Sequence:
LLQNLLTGLVRHERIEASWARVDELRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIP
KLFQVLAPRFQGQNGGYTRMLQIPNRNEQDRAKMAVIEY
Structures of the domain F1RMQ4 28-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 R 28-126 None


© NPIDB team 2003 - 2019

text