Pfam domain
Pfam family: Ribosomal_L14 (PF00238.18)
Uniprot AC: F1RQV7
RecName: Uncharacterized protein
Begin-End: 80-193
Organism: Sus scrofa
Interaction Mode:   

Sequence:
IQKMTRVRVVDNSALGTTPYHRPPRCIHVYNKTGVGKVGDRILLAIRGQKKKALIVGHRM
PGPRMTPRFDSNNVVLLEDNGNPVGTRIKTPIPSSLRQREGEFSKVLAIAQNFV
Structures of the domain F1RQV7 80-193
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 O 32-145 None


© NPIDB team 2003 - 2020

text