Pfam domain
Pfam family: Ribosomal_L2_C (PF03947.17)
Uniprot AC: F1RRN2
RecName: Uncharacterized protein
Begin-End: 178-280
Organism: Sus scrofa
Interaction Mode:   

Sequence:
REGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQV
LETCIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGLWQRKG
Structures of the domain F1RRN2 178-280
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 D 179-272 None


© NPIDB team 2003 - 2020

text