Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: F1RRN2
RecName: Uncharacterized protein
Begin-End: 84-166
Organism: Sus scrofa
Interaction Mode:   

Sequence:
GRNHTGQIQVHGIGGGHKQRYRMIDFLRFRPEHESKPGPFEEKVIAVRYDPCRSADIALV
AGGNRKRWIIATENMKAGDTVLN
Structures of the domain F1RRN2 84-166
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 D 84-165 None


© NPIDB team 2003 - 2019

text