Pfam domain
Pfam family: Ribosomal_L27A (PF00828.18)
Uniprot AC: F1RSH0
RecName: Uncharacterized protein
Begin-End: 45-176
Organism: Sus scrofa
Interaction Mode:   

Sequence:
RGRKCGRGHKGERQRGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRHQYQPLSLNRLQYL
IDLGRVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQMASELAI
AAIEKNGGVVTT
Structures of the domain F1RSH0 45-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 P 45-175 None


© NPIDB team 2003 - 2020

text