Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: F1RT79
RecName: Uncharacterized protein
Begin-End: 35-112
Organism: Sus scrofa
Interaction Mode:   

Sequence:
TGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEE
GVVRYTKEVYVPNPSNSE
Structures of the domain F1RT79 35-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 0 36-101 None


© NPIDB team 2003 - 2019

text