Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: F1RU54
RecName: Uncharacterized protein
Begin-End: 17-78
Organism: Sus scrofa
Interaction Mode:   

Sequence:
SGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDR
TF
Structures of the domain F1RU54 17-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 K 20-78 None


© NPIDB team 2003 - 2019

text