Pfam domain
Pfam family: Ribosomal_L11 (PF00298.18)
Uniprot AC: F1RU54
RecName: Uncharacterized protein
Begin-End: 83-155
Organism: Sus scrofa
Interaction Mode:   

Sequence:
GQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVR
SIIGSARSLGIRV
Structures of the domain F1RU54 83-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 K 84-155 None


© NPIDB team 2003 - 2020

text