Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: F1RWJ0
RecName: Mitochondrial ribosomal protein L10
Begin-End: 80-171
Organism: Sus scrofa
Interaction Mode:   

Sequence:
RLLRREIAAVFRDNRMIAVCQHVALSAEDKLLLRHQLRKHKILMKIFPNQVLKPFLEESK
YQNLLPLFVGHNLLLVSEEPKVKEMVRILKGI
Structures of the domain F1RWJ0 80-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 J 84-162 None


© NPIDB team 2003 - 2019

text