Pfam domain
Pfam family: Ribosomal_L21p (PF00829.20)
Uniprot AC: F1RY70
RecName: Mitochondrial ribosomal protein L21
Begin-End: 99-202
Organism: Sus scrofa
Interaction Mode:   

Sequence:
LFAVVHFAGHQWKVTAEDLILIENELDVACGERIRLEKVLLVGADNFTLLGKPLLGKELV
RVEATVIEKTESWPKINMKFQKRKNYQRKRITVNPQTVLRINSI
Structures of the domain F1RY70 99-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ce4 X-ray 4.9 V 2-202 None
4v19 X-ray 3.4 V 100-202 None


© NPIDB team 2003 - 2020

text