Pfam domain
Pfam family: Ribosomal_L4 (PF00573.21)
Uniprot AC: F1S3J8
RecName: Mitochondrial ribosomal protein L4
Begin-End: 63-255
Organism: Sus scrofa
Interaction Mode:   

Sequence:
TELHPDVFSTAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKPWVQKGSGRARHG
SIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDLHIVDSLELPTAD
PQYLIELARYRRWGDSVLLVDLEHEDMPQNVVAATSGLKTFNLVPAVGLNVHSMLKHQTL
VLTLPTVAFLEEK
Structures of the domain F1S3J8 63-255
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 F 81-272 None


© NPIDB team 2003 - 2020

text