Pfam domain
Pfam family: MRP-L47 (PF06984.12)
Uniprot AC: F1SGC7
RecName: Mitochondrial ribosomal protein L47
Begin-End: 66-151
Organism: Sus scrofa
Interaction Mode:   

Sequence:
LEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQR
LPMPSPERLEKVVDSMDALDKVVQER
Structures of the domain F1SGC7 66-151
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 2 66-151 None


© NPIDB team 2003 - 2020

text