Pfam domain
Pfam family: Ribosomal_L35p (PF01632.18)
Uniprot AC: F1SVC5
RecName: Uncharacterized protein
Begin-End: 103-162
Organism: Sus scrofa
Interaction Mode:   

Sequence:
KRKTVKAVIYRFLRLHSGLWLRRKAGYKKKLWKKTAARKRRLREFVFCNKTQSKLLDKMT
Structures of the domain F1SVC5 103-162
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 8 102-161 None


© NPIDB team 2003 - 2019

text