Pfam domain
Pfam family: RNA_pol_Rpb8 (PF03870.14)
Uniprot AC: F2Z4H3
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC3
Begin-End: 7-147
Organism: Bos taurus
Interaction Mode:   

Sequence:
EDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYE
DGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQ
GDANNLHGFEVDSRVYLLMKK
Structures of the domain F2Z4H3 7-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 H 7-147 None
5flm X-ray 3.4 H 7-147 None


© NPIDB team 2003 - 2019

text