Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.24)
Uniprot AC: F2Z602
RecName: KLLA0B11231p
Begin-End: 31-144
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
KRLLGTAFKSSPFGGSSHAKGIVLEKIGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPND
GCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPR
Structures of the domain F2Z602 31-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j80 X-ray 3.75 X 32-144 None
3jam X-ray 3.46 X 32-144 None
3jaq X-ray 6 X 32-144 None
3j81 X-ray 4 X 32-144 None
3jap X-ray 4.9 X 32-144 None


© NPIDB team 2003 - 2019

text