Pfam domain
Pfam family: Tospo_nucleocap (PF01533.15)
Uniprot AC: F4ZD19
RecName: Nucleoprotein
Begin-End: 2-244
Organism: Tomato spotted wilt virus
Interaction Mode:   

Sequence:
SKVKLTKENIVALLTQGKDLEFEENQNLVAFNFKTFCLENLDQIKKMSIISCLTFLKNRQ
SIMKVIKQSDFTFGKITIKKTSDRIGATDMTFRRLDSLIRVRLVEETGNSENLNTIKSKI
ASHPLIQAYGLPLDDAKSVRLAIMLGGSLPLIASVDSFEMISVVLAIYQDAKYKDLGIDP
KKYDTKEALGKVCTVLKSKAFEMNEDQVKKGKEYAAILSSSNPNAKGSVAMEHYSETLNK
FYE
Structures of the domain F4ZD19 2-244
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ip3 X-ray 3 A 3-246 None
5ip3 X-ray 3 B 4-246 None
5ip3 X-ray 3 C 2-246 None
5ip2 X-ray 3.3 A 2-244 None
5ip2 X-ray 3.3 C 2-244 None
5ip2 X-ray 3.3 B 2-246 None


© NPIDB team 2003 - 2019

text