Pfam domain
Pfam family: UDG (PF03167.21)
Uniprot AC: F5HFA1
RecName: Uracil-DNA glycosylase
Begin-End: 74-241
Organism: Human herpesvirus 8 type P (isolate GK18)
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
CCDPEDIKVVILGQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSHGC
LDSWARQGVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISSKLEHCVFLLWGRKAID
RTPLINAQKHLVLTAQHPSPLASLGGRHSRWPRFQGCNHFNLANDYLT
Structures of the domain F5HFA1 74-241
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nnu X-ray 2.97 E 77-244  H-Bb H-Mj H-Mn L-Bb 
5nnu X-ray 2.97 D 77-244  H-Bb H-Mj H-Mn L-Bb 
5nnu X-ray 2.97 B 77-244  H-Bb H-Mj H-Mn L-Bb 
5nnu X-ray 2.97 A 77-244  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2021

text