Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.24)
Uniprot AC: F6DEQ7
RecName: 30S ribosomal protein S12
Begin-End: 15-126
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
REKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEG
HNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPK
Structures of the domain F6DEQ7 15-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4lfa X-ray 3.65 L 15-126 None
4dr2 X-ray 3.25 L 15-126 None
4nxn X-ray 3.54 L 15-126 None
4dr5 X-ray 3.45 L 15-126 None
4dr6 X-ray 3.3 L 15-126 None
4dr7 X-ray 3.75 L 15-126 None
4dr4 X-ray 3.97 L 15-126 None
4dr3 X-ray 3.35 L 15-126 None
4dr1 X-ray 3.6 L 15-126 None
4lf4 X-ray 3.34 L 15-126 None
4lf6 X-ray 3.31 L 15-126 None
4lfc X-ray 3.6 L 15-126 None
4lf8 X-ray 3.15 L 15-126 None
4lf5 X-ray 3.75 L 15-126 None
4lfb X-ray 3.01 L 15-126 None
4lf9 X-ray 3.28 L 15-126 None
4lf7 X-ray 3.15 L 15-126 None
4nxm X-ray 3.65 L 15-126 None


© NPIDB team 2003 - 2019

text