Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: F7WD42
RecName: Uncharacterized protein
Begin-End: 285-386
Organism: Sordaria macrospora
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LAGFVSGDGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSR
GPWLYYTVTNFSDIQGKIIPFFHQYKIIGSKYGDYMDWCKIA
Structures of the domain F7WD42 285-386
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e67 X-ray 2.2 A 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
5e5s X-ray 2.29 A 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
5e5o X-ray 2.36 A 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
4z1z X-ray 3.2 A 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
4z1z X-ray 3.2 B 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
4lox X-ray 1.98 A 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
4z20 X-ray 3.2 A 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
4z20 X-ray 3.2 D 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 
5e63 X-ray 2.6 A 172-272  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text