Pfam domain
Pfam family: XPG_N (PF00752.19)
Uniprot AC: G0RYN2
RecName: Nuclease-like protein
Begin-End: 2-84
Organism: Chaetomium thermophilum
Interaction Mode:  H-Bb L-Bb L-Mj L-Mn 

Sequence:
GIKGIYKEIGSGERISLCKLAIDHLEQHNRPLRLAIDMAIWQFQIQAARGGSNPAIRTLF
YRFVRLLSLGIHPIFVFDGPNKP
Structures of the domain G0RYN2 2-84
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5cnq X-ray 2.6 A 2-107 None
5co8 X-ray 2.4 C 2-109  H-Bb L-Mj 
5co8 X-ray 2.4 A 2-109  H-Bb L-Bb L-Mj L-Mn 
6grc X-ray 2.45 A 2-106 None
6grb X-ray 2.4 A 2-108  H-Bb 
6grd X-ray 2.66 A 2-106  H-Bb 


© NPIDB team 2003 - 2021

text