Pfam domain
Pfam family: GEN1_C (PF18380.3)
Uniprot AC: G0RYN2
RecName: Nuclease-like protein
Begin-End: 361-462
Organism: Chaetomium thermophilum
Interaction Mode:  S-Bb 

Sequence:
LVKGISMRREHFSTDATPELRVSFIPAELVGLDPGQEPEVQVEAFGRSGLALNSDDEFDE
DISSSQKAPKKPFDPWQPDLAWVPETILKLGVPVTVEDWEEG
Structures of the domain G0RYN2 361-462
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5cnq X-ray 2.6 A 361-431 None
5co8 X-ray 2.4 A 361-432  S-Bb 
5co8 X-ray 2.4 C 361-432 None
6grc X-ray 2.45 A 361-431 None
6grb X-ray 2.4 A 361-431 None
6grd X-ray 2.66 A 361-431 None


© NPIDB team 2003 - 2021

text