Pfam domain
Pfam family: SET (PF00856.30)
Uniprot AC: G0S676
RecName: Histone-lysine N-methyltransferase, H3 lysine-36 specific
Begin-End: 191-297
Organism: Chaetomium thermophilum
Interaction Mode:   

Sequence:
GYGLRADTDLQPNDFIYEYVGEVINEPTFRSRMLKYDKEGIKHFYFMSLTKNEFVDATKK
GNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFAARYIKAGEELVFNYN
Structures of the domain G0S676 191-297
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6px3 X-ray 4.1 S 191-297  L-Bb 
6nzo X-ray 3.8 S 191-297  L-Bb 


© NPIDB team 2003 - 2021

text