Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: G0YYQ5
RecName: LGP2
Begin-End: 348-473
Organism: Gallus gallus
Interaction Mode:   

Sequence:
RLSKLEEILQEHFQPPGSSRGIVFTKTRQSAHSLLSWLQDTAGLCGQHIRAAVLTGSGHS
NQAKGMTQNEQQDVITLFRYGELNLLFSTSVAEEGLDIPECNIVVRYGLMTNEIAMVQAQ
GRARAQ
Structures of the domain G0YYQ5 348-473
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jb2 X-ray 2.2 A 365-472 None
5jbg X-ray 2 A 352-472 None
5jbj X-ray 3.58 A 365-472 None
5jaj X-ray 1.5 A 350-472 None


© NPIDB team 2003 - 2019

text