Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: G1SFR8
RecName: 40S ribosomal protein S12
Begin-End: 16-111
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
TALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQIN
LIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVV
Structures of the domain G1SFR8 16-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 M 17-110 None
4kzx X-ray 7.81 M 17-110 None
4kzz X-ray 7.03 M 17-110 None
4kzy X-ray 7.01 M 17-110 None
5k0y X-ray 5.8 r 17-110 None
4d61 X-ray 9 M 17-110 None


© NPIDB team 2003 - 2019

text