Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: G1SJB4
RecName: Uncharacterized protein
Begin-End: 224-260
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
GKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWD
Structures of the domain G1SJB4 224-260
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 g 224-260 None
4d5l X-ray 9 g 145-177 None
4d5l X-ray 9 g 187-219 None
4d5l X-ray 9 g 54-90 None
4d5l X-ray 9 g 96-132 None
4kzx X-ray 7.81 g 55-91 None
4kzx X-ray 7.81 g 97-133 None
4kzx X-ray 7.81 g 146-178 None
4kzx X-ray 7.81 g 188-220 None
4kzx X-ray 7.81 g 225-260 None
4kzz X-ray 7.03 g 224-260 None
4kzz X-ray 7.03 g 54-90 None
4kzz X-ray 7.03 g 96-132 None
4kzz X-ray 7.03 g 187-219 None
4kzz X-ray 7.03 g 145-177 None
4kzy X-ray 7.01 g 225-260 None
4kzy X-ray 7.01 g 55-91 None
4kzy X-ray 7.01 g 97-133 None
4kzy X-ray 7.01 g 146-178 None
4kzy X-ray 7.01 g 188-220 None
5k0y X-ray 5.8 m 225-260 None
5k0y X-ray 5.8 m 188-220 None
5k0y X-ray 5.8 m 146-178 None
5k0y X-ray 5.8 m 97-133 None
5k0y X-ray 5.8 m 55-91 None
4d61 X-ray 9 g 225-260 None
4d61 X-ray 9 g 188-220 None
4d61 X-ray 9 g 97-133 None
4d61 X-ray 9 g 146-178 None
4d61 X-ray 9 g 55-91 None


© NPIDB team 2003 - 2019

text