Pfam domain
Pfam family: Ribosomal_S27 (PF01599.18)
Uniprot AC: G1SK22
RecName: Uncharacterized protein
Begin-End: 102-147
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
VLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT
Structures of the domain G1SK22 102-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 f 102-147 None
4kzx X-ray 7.81 f 102-147 None
4kzz X-ray 7.03 f 34-79 None
4kzy X-ray 7.01 f 102-147 None
5k0y X-ray 5.8 p 26-71 None
4d61 X-ray 9 f 102-147 None


© NPIDB team 2003 - 2019

text