Pfam domain
Pfam family: Ribosomal_S13_N (PF08069.11)
Uniprot AC: G1SP51
RecName: Uncharacterized protein
Begin-End: 2-60
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
GRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGV
Structures of the domain G1SP51 2-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 N 2-60 None
4kzx X-ray 7.81 N 2-60 None
4kzz X-ray 7.03 N 32-90 None
4kzy X-ray 7.01 N 32-90 None
5k0y X-ray 5.8 Z 2-60 None
4d61 X-ray 9 N 2-60 None


© NPIDB team 2003 - 2019

text