Pfam domain
Pfam family: Ribosomal_S15 (PF00312.21)
Uniprot AC: G1SP51
RecName: Uncharacterized protein
Begin-End: 70-148
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
KILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYY
KTKRVLPPNWKYESSTASA
Structures of the domain G1SP51 70-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 N 74-146 None
4kzx X-ray 7.81 N 74-146 None
4kzz X-ray 7.03 N 104-146 None
4kzy X-ray 7.01 N 104-146 None
5k0y X-ray 5.8 Z 74-146 None
4d61 X-ray 9 N 74-146 None


© NPIDB team 2003 - 2019

text