Pfam domain
Pfam family: Ribosomal_S3Ae (PF01015.17)
Uniprot AC: G1SS70
RecName: 40S ribosomal protein S3a
Begin-End: 21-221
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
VVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVA
FRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCV
GFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKA
CQSIYPLHDVFVRKVKMLKKP
Structures of the domain G1SS70 21-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 B 21-221 None
4d61 X-ray 9 B 4-221 None


© NPIDB team 2003 - 2019

text