Pfam domain
Pfam family: Ribosomal_S5_C (PF03719.14)
Uniprot AC: G1SWM1
RecName: Uncharacterized protein
Begin-End: 147-217
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
TGRCGSLVRLIPAPRGTGIVSAPVPKKLLLMAGIDDCYTSARGCTATLGNFAKATFDAIS
KTYSYLTPDLW
Structures of the domain G1SWM1 147-217
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d61 X-ray 9 C 185-256 None


© NPIDB team 2003 - 2019

text