Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: G1SWM1
RecName: Uncharacterized protein
Begin-End: 64-128
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGLKCSKEVATAIRGAIILAKLS
IVPVR
Structures of the domain G1SWM1 64-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d61 X-ray 9 C 102-166 None


© NPIDB team 2003 - 2019

text