Pfam domain
Pfam family: Ribosomal_S11 (PF00411.18)
Uniprot AC: G1T1F0
RecName: Uncharacterized protein
Begin-End: 34-152
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
GVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKEL
GITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRR
Structures of the domain G1T1F0 34-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5k0y X-ray 5.8 j 17-147 None
4d61 X-ray 9 O 29-147 None


© NPIDB team 2003 - 2019

text