Pfam domain
Pfam family: EIF_2_alpha (PF07541.11)
Uniprot AC: G1T2G4
RecName: Eukaryotic translation initiation factor 2 subunit 1
Begin-End: 130-244
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
LFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAV
KIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTTTLER
Structures of the domain G1T2G4 130-244
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5k0y X-ray 5.8 P 131-243 None


© NPIDB team 2003 - 2019

text