Pfam domain
Pfam family: Ribosomal_S30 (PF04758.13)
Uniprot AC: G1T8A2
RecName: 40S ribosomal protein S30
Begin-End: 80-130
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
LARVGKVRGQTLKVAKQEKKKKRTGRAKRRMQYNRRFVNVVPTFGKKKGPN
Structures of the domain G1T8A2 80-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 e 2-52 None
4d61 X-ray 9 e 6-56 None


© NPIDB team 2003 - 2019

text