Pfam domain
Pfam family: Ribosomal_S25 (PF03297.14)
Uniprot AC: G1TDB3
RecName: Uncharacterized protein
Begin-End: 40-112
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
VRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKL
VSKHRAQVIYTRN
Structures of the domain G1TDB3 40-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 Z 40-112 None
4kzx X-ray 7.81 Z 41-112 None
4kzz X-ray 7.03 Z 41-112 None
4kzy X-ray 7.01 Z 41-112 None
5k0y X-ray 5.8 W 41-112 None
4d61 X-ray 9 Z 40-112 None


© NPIDB team 2003 - 2019

text