Pfam domain
Pfam family: Ribosomal_S26e (PF01283.18)
Uniprot AC: G1TFE8
RecName: 40S ribosomal protein S26
Begin-End: 2-107
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
TKKRRNNGRAKKGRGHVQPIRCTNCACCVPKDKAIKKFVIRNIVEAAAVRDISEVSVFDA
YVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAA
Structures of the domain G1TFE8 2-107
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kzx X-ray 7.81 a 2-103 None
4kzz X-ray 7.03 a 2-103 None
4kzy X-ray 7.01 a 2-103 None


© NPIDB team 2003 - 2019

text