Pfam domain
Pfam family: Ribosomal_S26e (PF01283.18)
Uniprot AC: G1TFE8
RecName: 40S ribosomal protein S26
Begin-End: 2-97
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
TKKRRNNGRAKKGRGHVQPIRCTNCACCVPKDKAIKKFVIRNIVEAAAVRDISEVSVFDA
YVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTP
Structures of the domain G1TFE8 2-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 a 2-97 None
5k0y X-ray 5.8 k 7-105 None
4d61 X-ray 9 a 2-97 None


© NPIDB team 2003 - 2019

text