Pfam domain
Pfam family: Ribosomal_S7 (PF00177.20)
Uniprot AC: G1TFM5
RecName: Ribosomal protein S5
Begin-End: 51-204
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
HSAGRYAAKRFRKAQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQ
VLVNAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIA
ECLADELINAAKGSSNSYAIKKKDELERVAKSNR
Structures of the domain G1TFM5 51-204
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 F 136-204 None
4kzx X-ray 7.81 F 130-204 None
4kzz X-ray 7.03 F 62-204 None
4kzy X-ray 7.01 F 130-204 None
4d61 X-ray 9 F 136-204 None


© NPIDB team 2003 - 2019

text