Pfam domain
Pfam family: Ribosomal_S2 (PF00318.19)
Uniprot AC: G1TGI6
RecName: 40S ribosomal protein SA
Begin-End: 20-120
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
FLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVI
SSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFRE
Structures of the domain G1TGI6 20-120
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kzx X-ray 7.81 A 19-112 None
4kzz X-ray 7.03 A 19-112 None
4kzy X-ray 7.01 A 19-112 None


© NPIDB team 2003 - 2019

text