Pfam domain
Pfam family: Ribosomal_S8e (PF01201.21)
Uniprot AC: G1TJW1
RecName: 40S ribosomal protein S8
Begin-End: 2-190
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
GISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVGVRGGNKKYRALRLD
VGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPL
GRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQ
CGRADGYVL
Structures of the domain G1TJW1 2-190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 I 2-190 None
4kzx X-ray 7.81 I 1-189 None
4kzz X-ray 7.03 I 2-190 None
4kzy X-ray 7.01 I 2-190 None
5k0y X-ray 5.8 o 239-190 None
4d61 X-ray 9 I 201-389 None


© NPIDB team 2003 - 2019

text