Pfam domain
Pfam family: 40S_S4_C (PF16121.4)
Uniprot AC: G1TK17
RecName: 40S ribosomal protein S4
Begin-End: 212-258
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
DANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAA
Structures of the domain G1TK17 212-258
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 E 212-257 None
4kzx X-ray 7.81 E 212-259 None
4kzz X-ray 7.03 E 212-259 None
4kzy X-ray 7.01 E 212-259 None
5k0y X-ray 5.8 I 230-259 None
4d61 X-ray 9 E 212-257 None


© NPIDB team 2003 - 2019

text