Pfam domain
Pfam family: RS4NT (PF08071.11)
Uniprot AC: G1TK17
RecName: 40S ribosomal protein S4
Begin-End: 3-39
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
RGPKKHLKRVAAPKHWMLDKLTSVFAPRPSTGPHKLR
Structures of the domain G1TK17 3-39
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 E 3-39 None
4kzx X-ray 7.81 E 3-39 None
4kzz X-ray 7.03 E 77-113 None
4kzy X-ray 7.01 E 3-39 None
5k0y X-ray 5.8 I 21-57 None
4d61 X-ray 9 E 7-43 None


© NPIDB team 2003 - 2019

text