Pfam domain
Pfam family: Ribosomal_S6e (PF01092.18)
Uniprot AC: G1TM55
RecName: 40S ribosomal protein S6
Begin-End: 1-126
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQG
FPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKD
IPGLTD
Structures of the domain G1TM55 1-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 G 1-126 None
4kzx X-ray 7.81 G 2-127 None
4kzz X-ray 7.03 G 1-126 None
4kzy X-ray 7.01 G 2-127 None
5k0y X-ray 5.8 q 1-126 None
4d61 X-ray 9 G 2-127 None


© NPIDB team 2003 - 2019

text