Pfam domain
Pfam family: Ribosomal_S21e (PF01249.17)
Uniprot AC: G1TM82
RecName: 40S ribosomal protein S21
Begin-End: 1-80
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
MQSNAGEFVDLYVPRKCSASNRIIGAKDHASIPMNVAEVDKVTGRFNGQSKTYAICGAIR
RMGESDDSILRLAKSHGIVS
Structures of the domain G1TM82 1-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 V 1-79 None
4kzx X-ray 7.81 V 1-79 None
4kzz X-ray 7.03 V 1-79 None
4kzy X-ray 7.01 V 1-79 None
5k0y X-ray 5.8 b 1-79 None
4d61 X-ray 9 V 1-79 None


© NPIDB team 2003 - 2019

text